Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
S100b (Mouse) Recombinant Protein
Abnova
S100b (Mouse) Recombinant Protein
Ref: AB-P4340
S100b (Mouse) Recombinant Protein
Contáctenos
Información del producto
Mouse S100b (NP_033141, 1 a.a. - 92 a.a.) full-length recombinant protein with His tag expressed in
Escherichia coli
.
Información adicional
Size
100 ug
Gene Name
S100b
Gene Alias
AI850290|Bpb|MGC74317
Gene Description
S100 protein, beta polypeptide, neural
Storage Conditions
Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration
1 mg/mL
Application Key
SDS-PAGE
Immunogen Prot. Seq
MGSSHHHHHHSSGLVPRGSHMSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVAMVTTACHEFFEHE
Form
Liquid
Antigen species Target species
Mouse
Quality control testing
15% SDS-PAGE Stained with Coomassie Blue
Storage Buffer
In 20 mM Tris-HCl buffer, pH 8.0 (1 mM DTT, 10% glycerol).
Gene ID
20203
Enviar un mensaje
S100b (Mouse) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*