Ver mas grande
Gstm1 (Mouse) Recombinant Protein
AB-P4334
Producto nuevo
Gstm1 (Mouse) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | Gstm1 |
| Gene Alias | Gstb-1|Gstb1 |
| Gene Description | glutathione S-transferase, mu 1 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MPMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK |
| Form | Liquid |
| Antigen species Target species | Mouse |
| Quality control testing | 15% SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | In PBS, pH 7.4 (5 mM glutathione). |
| Gene ID | 14862 |
Más información
Mouse Gstm1 (NP_034488, 1 a.a. - 218 a.a.) full-length recombinant protein expressed in Escherichia coli.