Lep (Mouse) Recombinant Protein
  • Lep (Mouse) Recombinant Protein

Lep (Mouse) Recombinant Protein

Ref: AB-P4327
Lep (Mouse) Recombinant Protein

Información del producto

Mouse Lep (NP_032519, 2 a.a. - 147 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name Lep
Gene Alias ob|obese
Gene Description leptin
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC
Form Liquid
Antigen species Target species Mouse
Quality control testing 15% SDS-PAGE Stained with Coomassie Blue
Storage Buffer In PBS, pH 7.4.
Gene ID 16846

Enviar un mensaje


Lep (Mouse) Recombinant Protein

Lep (Mouse) Recombinant Protein