ABO (Human) Recombinant Protein Ver mas grande

ABO (Human) Recombinant Protein

AB-P3941

Producto nuevo

ABO (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 50 ug
Gene Name ABO
Gene Alias A3GALNT|A3GALT1|GTB|NAGAT
Gene Description ABO blood group (transferase A, alpha 1-3-N-acetylgalactosaminyltransferase
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Concentration 0.5 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMAVREPDHLQRVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSSREAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQA
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS PAGE.
Storage Buffer In 20 mM Tris-HCl buffer, 200 mM NaCl, pH 8.0 (2 mM DTT, 20% glycerol).
Gene ID 28

Más información

Human ABO (NP_065202, 54 a.a. - 354 a.a. ) full-length recombinant protein with His tag expressed in Escherichia coli.

Consulta sobre un producto

ABO (Human) Recombinant Protein

ABO (Human) Recombinant Protein