F3 (Human) Recombinant Protein Ver mas grande

F3 (Human) Recombinant Protein

AB-P3830

Producto nuevo

F3 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 10 ug
Gene Name F3
Gene Alias CD142|TF|TFA
Gene Description coagulation factor III (thromboplastin, tissue factor)
Storage Conditions Store at -20ºC. For long term storage store at -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC,ELISA,Dot,SDS-PAGE
Immunogen Prot. Seq SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE
Form Liquid
Antigen species Target species Human
Quality control testing 10% SDS-PAGE Result
Storage Buffer In saline or Tris (50% glycerol)
Gene ID 2152

Más información

Human F3 (NP_001984.1, 33 a.a. - 251 a.a.) partial recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

F3 (Human) Recombinant Protein

F3 (Human) Recombinant Protein