Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
IL1R1 (Human) Recombinant Protein
Abnova
IL1R1 (Human) Recombinant Protein
Ref: AB-P3829
IL1R1 (Human) Recombinant Protein
Contáctenos
Información del producto
Human IL1R1 (NP_003847.2, 19 a.a. - 328 a.a.) partial recombinant protein expressed in
Escherichia coli
.
Información adicional
Size
10 ug
Gene Name
IL1R1
Gene Alias
CD121A|D2S1473|IL-1R-alpha|IL1R|IL1RA|P80
Gene Description
interleukin 1 receptor, type I
Storage Conditions
Store at -20C. For long term storage store at -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key
SDS-PAGE
Immunogen Prot. Seq
KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQN
Form
Liquid
Antigen species Target species
Human
Quality control testing
10% SDS-PAGE Result
Storage Buffer
In PBS (50% glycerol)
Gene ID
3554
Enviar un mensaje
IL1R1 (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*