Ver mas grande
HGF (Human) Recombinant Protein
AB-P3806
Producto nuevo
HGF (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | HGF |
| Gene Alias | F-TCF|HGFB|HPTA|SF |
| Gene Description | hepatocyte growth factor (hepapoietin A |
| Storage Conditions | Store at -20ºC. For long term storage store at -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | 10% SDS-PAGE Result |
| Storage Buffer | In PBS (50% glycerol) |
| Gene ID | 3082 |
Más información
Human HGF (NP_000592.3, 495 a.a. - 728 a.a.) partial recombinant protein expressed in Escherichia coli.