Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
HGF (Human) Recombinant Protein
Abnova
HGF (Human) Recombinant Protein
Ref: AB-P3806
HGF (Human) Recombinant Protein
Contáctenos
Información del producto
Human HGF (NP_000592.3, 495 a.a. - 728 a.a.) partial recombinant protein expressed in
Escherichia coli
.
Información adicional
Size
10 ug
Gene Name
HGF
Gene Alias
F-TCF|HGFB|HPTA|SF
Gene Description
hepatocyte growth factor (hepapoietin A
Storage Conditions
Store at -20ºC. For long term storage store at -80ºC.
Aliquot to avoid repeated freezing and thawing.
Application Key
SDS-PAGE
Immunogen Prot. Seq
VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS
Form
Liquid
Antigen species Target species
Human
Quality control testing
10% SDS-PAGE Result
Storage Buffer
In PBS (50% glycerol)
Gene ID
3082
Enviar un mensaje
HGF (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*