Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
SNRPF (Human) Recombinant Protein
Abnova
SNRPF (Human) Recombinant Protein
Ref: AB-P3773
SNRPF (Human) Recombinant Protein
Contáctenos
Información del producto
Human SNRPF (P46778) full-length recombinant protein expressed in yeast.
Información adicional
Size
100 ug
Gene Name
SNRPF
Gene Alias
SMF
Gene Description
small nuclear ribonucleoprotein polypeptide F
Storage Conditions
Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key
SDS-PAGE
Immunogen Prot. Seq
MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEEDGEMRE
Form
Liquid
Antigen species Target species
Human
Storage Buffer
In 50 mM HEPES, 100mM NaCl, pH 7.5 (30% glycerol, 30 mM Glutathione, 0.5% TritonX-100, 1 mM dithiothreitol)
Gene ID
6636
Enviar un mensaje
SNRPF (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*