ANP32C (Human) Recombinant Protein
  • ANP32C (Human) Recombinant Protein

ANP32C (Human) Recombinant Protein

Ref: AB-P3771
ANP32C (Human) Recombinant Protein

Información del producto

Human ANP32C (O43423) full-length recombinant protein expressed in yeast.
Información adicional
Size 100 ug
Gene Name ANP32C
Gene Alias PP32R1
Gene Description acidic (leucine-rich) nuclear phosphoprotein 32 family, member C
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MEMGRRIHSELRNRAPSDVKELALDNSRSNEGKLEALTDEFEELEFLSKINGGLTSISDLPKLKLRKLELRVSGGLEVLAEKCPNLTHLYLSGNKIKDLSTIEPLKQLENLKSLDLFNCEVTNLNDYGENVFKLLLQLTYLDSCYWDHKEAPYSDIEDHVEGLDDEEEGEHEEEYDEDAQVVEDEEGEEEEEEGEEEDVSGGDEEDEEGYNDGEVDGEEDEEELGEEERGQKRK
Form Liquid
Antigen species Target species Human
Storage Buffer In 50 mM HEPES, 100mM NaCl, pH 7.5 (30% glycerol, 30 mM Glutathione, 0.5% TritonX-100, 1 mM dithiothreitol)
Gene ID 23520

Enviar un mensaje


ANP32C (Human) Recombinant Protein

ANP32C (Human) Recombinant Protein