ATOX1 (Human) Recombinant Protein
  • ATOX1 (Human) Recombinant Protein

ATOX1 (Human) Recombinant Protein

Ref: AB-P3737
ATOX1 (Human) Recombinant Protein

Información del producto

Human ATOX1 (NP_004036.1) full-length recombinant protein expressed in yeast.
Información adicional
Size 100 ug
Gene Name ATOX1
Gene Alias ATX1|HAH1|MGC138453|MGC138455
Gene Description ATX1 antioxidant protein 1 homolog (yeast)
Storage Conditions Store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Form Liquid
Antigen species Target species Human
Storage Buffer In 50 mM HEPES, 100mM NaCl, pH 7.5 (30% glycerol, 30 mM Glutathione, 0.5% TritonX-100, 1 mM dithiothreitol)
Gene ID 475

Enviar un mensaje


ATOX1 (Human) Recombinant Protein

ATOX1 (Human) Recombinant Protein