NDUFAF2 (Human) Recombinant Protein
  • NDUFAF2 (Human) Recombinant Protein

NDUFAF2 (Human) Recombinant Protein

Ref: AB-P3721
NDUFAF2 (Human) Recombinant Protein

Información del producto

Human NDUFAF2 (NP_777549, 1 a.a. - 169 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name NDUFAF2
Gene Alias B17.2L|FLJ22398|MMTN|NDUFA12L|mimitin
Gene Description NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, assembly factor 2
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.5 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGWSQDLFRALWRSLSREVKEHVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTEWEAWIRRTRKTPPTMEEILKNEKHREEIKIKSQDFYEKEKLLSKETSEELLPPPVQTQIKGHASAPYFGKEEPSVAPSSTGKTFQPGSWMPRDGKSHNQ
Form Liquid
Antigen species Target species Human
Storage Buffer In 20 mM Tris-HCl buffer, 200 mM NaCl, pH 8.0 (1 mM DTT, 20% glycerol).
Gene ID 91942

Enviar un mensaje


NDUFAF2 (Human) Recombinant Protein

NDUFAF2 (Human) Recombinant Protein