Ver mas grande
NANOG (Human) Recombinant Protein
AB-P3718
Producto nuevo
NANOG (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | NANOG |
| Gene Alias | - |
| Gene Description | Nanog homeobox |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 0.25 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQ |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | In 20 mM Tris-HCl buffer, pH 8.0 (20% glycerol, 1 mM DTT). |
| Gene ID | 79923 |
Más información
Human NANOG (NP_079141, 1 a.a. - 154 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.