Ver mas grande
CCL5 (Human) Recombinant Protein
AB-P3664
Producto nuevo
CCL5 (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | CCL5 |
| Gene Alias | D17S136E|MGC17164|RANTES|SCYA5|SISd|TCP228 |
| Gene Description | chemokine (C-C motif) ligand 5 |
| Storage Conditions | Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from PBS |
| Gene ID | 6352 |
Más información
Human CCL5 (P13501, 24 a.a. - 91 a.a.) partial recombinant protein expressed in Escherichia coli.