Ver mas grande
PDGFB (Human) Recombinant Protein
AB-P3661
Producto nuevo
PDGFB (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | PDGFB |
| Gene Alias | FLJ12858|PDGF2|SIS|SSV|c-sis |
| Gene Description | platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog) |
| Storage Conditions | Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 0.02 M acetic acid, pH 6.5 |
| Gene ID | 5155 |
Más información
Human PDGFB (P01127, 82 a.a. - 190 a.a.) partial recombinant protein expressed in Pichia pastoris.