CSF1 (Human) Recombinant Protein
  • CSF1 (Human) Recombinant Protein

CSF1 (Human) Recombinant Protein

Ref: AB-P3649
CSF1 (Human) Recombinant Protein

Información del producto

Human CSF1 (P09603, 33 a.a. - 181 a.a.) partial recombinant protein expressed in baculovirus infected Bombyx Mori.
Información adicional
Size 10 ug
Gene Name CSF1
Gene Alias MCSF|MGC31930
Gene Description colony stimulating factor 1 (macrophage)
Storage Conditions Store at -20C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4C for 1 month or store at -20C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQ
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS, pH 7.0 (1% HSA, 3% mannitol)
Gene ID 1435

Enviar un mensaje


CSF1 (Human) Recombinant Protein

CSF1 (Human) Recombinant Protein