LIF (Human) Recombinant Protein
  • LIF (Human) Recombinant Protein

LIF (Human) Recombinant Protein

Ref: AB-P3646
LIF (Human) Recombinant Protein

Información del producto

Human LIF (P15018, 23 a.a. - 202 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name LIF
Gene Alias CDF|DIA|HILDA
Gene Description leukemia inhibitory factor (cholinergic differentiation factor)
Storage Conditions Store at -20C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4C for 1 month or store at -20C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS, pH 4.5
Gene ID 3976

Enviar un mensaje


LIF (Human) Recombinant Protein

LIF (Human) Recombinant Protein