Ver mas grande
FGF7 (Human) Recombinant Protein
AB-P3645
Producto nuevo
FGF7 (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | FGF7 |
| Gene Alias | HBGF-7|KGF |
| Gene Description | fibroblast growth factor 7 (keratinocyte growth factor) |
| Storage Conditions | Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 1M NaCl, 20mM PB, pH 8.0 |
| Gene ID | 2252 |
Más información
Human FGF7 (P21781, 32 a.a. - 194 a.a.) partial recombinant protein expressed in Escherichia coli.