CXCL10 (Human) Recombinant Protein
  • CXCL10 (Human) Recombinant Protein

CXCL10 (Human) Recombinant Protein

Ref: AB-P3643
CXCL10 (Human) Recombinant Protein

Información del producto

Human CXCL10 (P02778, 22 a.a. - 98 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name CXCL10
Gene Alias C7|IFI10|INP10|IP-10|SCYB10|crg-2|gIP-10|mob-1
Gene Description chemokine (C-X-C motif) ligand 10
Storage Conditions Store at -20C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4C for 1 month or store at -20C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS, pH 7.0
Gene ID 3627

Enviar un mensaje


CXCL10 (Human) Recombinant Protein

CXCL10 (Human) Recombinant Protein