IL1A (Human) Recombinant Protein
  • IL1A (Human) Recombinant Protein

IL1A (Human) Recombinant Protein

Ref: AB-P3627
IL1A (Human) Recombinant Protein

Información del producto

Human IL1A (P01583, 113 a.a. - 271 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name IL1A
Gene Alias IL-1A|IL1|IL1-ALPHA|IL1F1
Gene Description interleukin 1, alpha
Storage Conditions Store at -20C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4C for 1 month or store at -20C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS, pH 7.0
Gene ID 3552

Enviar un mensaje


IL1A (Human) Recombinant Protein

IL1A (Human) Recombinant Protein