Ver mas grande
IFNB1 (Human) Recombinant Protein
AB-P3623
Producto nuevo
IFNB1 (Human) Recombinant Protein
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | IFNB1 |
| Gene Alias | IFB|IFF|IFNB|MGC96956 |
| Gene Description | interferon, beta 1, fibroblast |
| Storage Conditions | Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from sodium acetate solution pH 4.8 |
| Gene ID | 3456 |
Más información
Human IFNB1 (P01574, 22 a.a. - 187 a.a.) partial recombinant protein expressed in CHO cells.