GH1 (Human) Recombinant Protein
  • GH1 (Human) Recombinant Protein

GH1 (Human) Recombinant Protein

Ref: AB-P3613
GH1 (Human) Recombinant Protein

Información del producto

Human GH1 (P01241, 1 a.a. - 217 a.a.) full-length recombinant protein. expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name GH1
Gene Alias GH|GH-N|GHN|hGH-N
Gene Description growth hormone 1
Storage Conditions Store at -20C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4C for 1 month or store at -20C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 0.005 mM NaHCO3 solution pH 10
Gene ID 2688

Enviar un mensaje


GH1 (Human) Recombinant Protein

GH1 (Human) Recombinant Protein