FGF9 (Human) Recombinant Protein
  • FGF9 (Human) Recombinant Protein

FGF9 (Human) Recombinant Protein

Ref: AB-P3608
FGF9 (Human) Recombinant Protein

Información del producto

Human FGF9 (P31371, 1 a.a. - 208 a.a.) full-length recombinant protein. expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name FGF9
Gene Alias GAF|HBFG-9|MGC119914|MGC119915
Gene Description fibroblast growth factor 9 (glia-activating factor)
Storage Conditions Store at -20C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4C for 1 month or store at -20C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from PBS
Gene ID 2254

Enviar un mensaje


FGF9 (Human) Recombinant Protein

FGF9 (Human) Recombinant Protein