Ver mas grande
DEFB104A (Human) Recombinant Protein
AB-P3594
Producto nuevo
DEFB104A (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 20 ug |
| Gene Name | DEFB104A |
| Gene Alias | BD-4|DEFB-4|DEFB104|DEFB4|MGC118942|MGC118944|MGC118945|hBD-4 |
| Gene Description | defensin, beta 104A |
| Storage Conditions | Store at -20ºC on dry atmosphere for 2 years.<br>After reconstitution with deionized water, store at 4ºC for 1 month or store at -20ºC for 6 months.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized from 100 mM NaCl, 20 mM PB, pH 7.4 |
| Gene ID | 140596 |
Más información
Human DEFB104A (Q8WTQ1, 23 a.a. - 72 a.a.) partial recombinant protein expressed in Escherichia coli.