DEFB1 (Human) Recombinant Protein
  • DEFB1 (Human) Recombinant Protein

DEFB1 (Human) Recombinant Protein

Ref: AB-P3591
DEFB1 (Human) Recombinant Protein

Información del producto

Human DEFB1 (P60022, 33 a.a. - 70 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name DEFB1
Gene Alias BD1|DEFB-1|DEFB101|HBD1|MGC51822
Gene Description defensin, beta 1
Storage Conditions Store at -20C on dry atmosphere for 2 years.
After reconstitution with deionized water, store at 4C for 1 month or store at -20C for 6 months.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq RSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized from 100 mM NaCl, 20 mM PB, pH 7.4
Gene ID 1672

Enviar un mensaje


DEFB1 (Human) Recombinant Protein

DEFB1 (Human) Recombinant Protein