S100A14 (Human) Recombinant Protein
  • S100A14 (Human) Recombinant Protein

S100A14 (Human) Recombinant Protein

Ref: AB-P3573
S100A14 (Human) Recombinant Protein

Información del producto

Human S100A14 (NP_065723, 1 a.a. - 104 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name S100A14
Gene Alias BCMP84|S100A15
Gene Description S100 calcium binding protein A14
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, pH 8.0 (2 mM DTT, 10% glycerol).
Gene ID 57402

Enviar un mensaje


S100A14 (Human) Recombinant Protein

S100A14 (Human) Recombinant Protein