Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
CLIC4 (Human) Recombinant Protein
Abnova
CLIC4 (Human) Recombinant Protein
Ref: AB-P3572
CLIC4 (Human) Recombinant Protein
Contáctenos
Información del producto
Human CLIC4 (NP_039234, 1 a.a. - 253 a.a.) full-length recombinant protein with His tag expressed in
Escherichia coli
.
Información adicional
Size
100 ug
Gene Name
CLIC4
Gene Alias
CLIC4L|DKFZp566G223|FLJ38640|H1|MTCLIC|huH1|p64H1
Gene Description
chloride intracellular channel 4
Storage Conditions
Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration
0.5 mg/mL
Application Key
SDS-PAGE
Immunogen Prot. Seq
MGSSHHHHHHSSGLVPRGSHMALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCP
Form
Liquid
Antigen species Target species
Human
Quality control testing
Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer
In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (1 mM DTT, 10% glycerol).
Gene ID
25932
Enviar un mensaje
CLIC4 (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*