Ver mas grande
S100A5 (Human) Recombinant Protein
AB-P3571
Producto nuevo
S100A5 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | S100A5 |
| Gene Alias | S100D |
| Gene Description | S100 calcium binding protein A5 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 0.5 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESSIDDLMKSLDKNSDQEIDFKEYSVFLTMLCMAYNDFFLEDNK |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (1 mM DTT, 30% glycerol, 0.1 mM PMSF). |
| Gene ID | 6276 |
Más información
Human S100A5 (NP_002953, 1 a.a. - 92 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.