PHLDA2 (Human) Recombinant Protein
  • PHLDA2 (Human) Recombinant Protein

PHLDA2 (Human) Recombinant Protein

Ref: AB-P3550
PHLDA2 (Human) Recombinant Protein

Información del producto

Human PHLDA2 (NP_003302, 1 a.a. - 152 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name PHLDA2
Gene Alias BRW1C|BWR1C|HLDA2|IPL|TSSC3
Gene Description pleckstrin homology-like domain, family A, member 2
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.5 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (1 mM DTT, 20% glycerol).
Gene ID 7262

Enviar un mensaje


PHLDA2 (Human) Recombinant Protein

PHLDA2 (Human) Recombinant Protein