LGALS4 (Human) Recombinant Protein
  • LGALS4 (Human) Recombinant Protein

LGALS4 (Human) Recombinant Protein

Ref: AB-P3544
LGALS4 (Human) Recombinant Protein

Información del producto

Human LGALS4 (NP_006140, 1 a.a. - 323 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name LGALS4
Gene Alias GAL4|L36LBP
Gene Description lectin, galactoside-binding, soluble, 4
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSSGDIAL
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, pH 8.0 (1 mM DTT, 10% glycerol).
Gene ID 3960

Enviar un mensaje


LGALS4 (Human) Recombinant Protein

LGALS4 (Human) Recombinant Protein