AB-P3530
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Size | 100 ug |
Gene Name | VAMP5 |
Gene Alias | - |
Gene Description | vesicle-associated membrane protein 5 (myobrevin) |
Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Concentration | 0.5 mg/mL |
Application Key | SDS-PAGE |
Immunogen Prot. Seq | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYRIC |
Form | Liquid |
Antigen species Target species | Human |
Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
Storage Buffer | In 20 mM Tris-HCl buffer, 0.2 M NaCl, 0.5 mM EDTA, pH 8.0 (20% glycerol, 5 mM DTT). |
Gene ID | 10791 |