YWHAH (Human) Recombinant Protein
  • YWHAH (Human) Recombinant Protein

YWHAH (Human) Recombinant Protein

Ref: AB-P3524
YWHAH (Human) Recombinant Protein

Información del producto

Human YWHAH (NP_003396, 1 a.a. - 246 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name YWHAH
Gene Alias YWHA1
Gene Description tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTS
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris, pH 8.0.
Gene ID 7533

Enviar un mensaje


YWHAH (Human) Recombinant Protein

YWHAH (Human) Recombinant Protein