Ver mas grande
VAMP1 (Human) Recombinant Protein
AB-P3522
Producto nuevo
VAMP1 (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | VAMP1 |
| Gene Alias | DKFZp686H12131|SYB1|VAMP-1 |
| Gene Description | vesicle-associated membrane protein 1 (synaptobrevin 1) |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMSAPAQPPAEGTEGTAPGGGPPGPPPNMTSNRRLQQTQAQVEEVVDIIRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYW |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In PBS, 1 mM EDTA, pH 7.4. |
| Gene ID | 6843 |
Más información
Human VAMP1 (NP_055046, 1 a.a. - 91 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.