FKBP2 (Human) Recombinant Protein
  • FKBP2 (Human) Recombinant Protein

FKBP2 (Human) Recombinant Protein

Ref: AB-P3503
FKBP2 (Human) Recombinant Protein

Información del producto

Human FKBP2 (NP_001128680, 22 a.a. - 142 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name FKBP2
Gene Alias FKBP-13|PPIase
Gene Description FK506 binding protein 2, 13kDa
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris buffer, pH 8.0 (10% glycerol, 1 mM DTT).
Gene ID 2286

Enviar un mensaje


FKBP2 (Human) Recombinant Protein

FKBP2 (Human) Recombinant Protein