AKR1C3 (Human) Recombinant Protein
  • AKR1C3 (Human) Recombinant Protein

AKR1C3 (Human) Recombinant Protein

Ref: AB-P3481
AKR1C3 (Human) Recombinant Protein

Información del producto

Human AKR1C3 (NP_003730, 1 a.a. - 323 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name AKR1C3
Gene Alias DD3|DDX|HA1753|HAKRB|HAKRe|HSD17B5|KIAA0119|hluPGFS
Gene Description aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVL
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, pH 8.0 (10% glycerol).
Gene ID 8644

Enviar un mensaje


AKR1C3 (Human) Recombinant Protein

AKR1C3 (Human) Recombinant Protein