Ver mas grande
HRMT1L2 (Human) Recombinant Protein
AB-P3463
Producto nuevo
HRMT1L2 (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | PRMT1 |
| Gene Alias | ANM1|HCP1|HRMT1L2|IR1B4 |
| Gene Description | protein arginine methyltransferase 1 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MHHHHHHMKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVL |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In 40 mM Tris, 100 mM NaCl, 4 mM MgCl2, pH 8.0 (2 mM DTT, 40% glycerol). |
| Gene ID | 3276 |
Más información
Human HRMT1L2 (NP_938074, 1 a.a. - 353 a.a.) full-length recombinant protein with His-MBP tag expressed in Escherichia coli.