IL15 (Human) Recombinant Protein
  • IL15 (Human) Recombinant Protein

IL15 (Human) Recombinant Protein

Ref: AB-P3462
IL15 (Human) Recombinant Protein

Información del producto

Human IL15 (NP_751914, 49 a.a. - 162 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name IL15
Gene Alias IL-15|MGC9721
Gene Description interleukin 15
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTSLEHHHHHH
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In PBS, pH 7.4 (10% glycerol).
Gene ID 3600

Enviar un mensaje


IL15 (Human) Recombinant Protein

IL15 (Human) Recombinant Protein