Ver mas grande
IL15 (Human) Recombinant Protein
AB-P3462
Producto nuevo
IL15 (Human) Recombinant Protein
Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | IL15 |
| Gene Alias | IL-15|MGC9721 |
| Gene Description | interleukin 15 |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTSLEHHHHHH |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In PBS, pH 7.4 (10% glycerol). |
| Gene ID | 3600 |
Más información
Human IL15 (NP_751914, 49 a.a. - 162 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.