HK2 (Human) Recombinant Protein
  • HK2 (Human) Recombinant Protein

HK2 (Human) Recombinant Protein

Ref: AB-P3457
HK2 (Human) Recombinant Protein

Información del producto

Human HK2 (NP_000180, 1 a.a. - 917 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name HK2
Gene Alias DKFZp686M1669|HKII|HXK2
Gene Description hexokinase 2
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMIASHLLAYFFTELNHDQVQKVDQYLYHMRLSDETLLEISKRFRKEMEKGLGATTHPTAAVKMLPTFVRSTPDGTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSGTQLFDHIAECLANFMDKLQIKDKKLPLGFTFSFPCHQTKLDESFLVSWTKGFKSSGVEGRDVVALIRKAIQRRGDFDIDIVAVVNDTVGTMMTCGYDDHNCEIGLIVGTGSN
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 12% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl, pH 8.0 (10% glycerol).
Gene ID 3099

Enviar un mensaje


HK2 (Human) Recombinant Protein

HK2 (Human) Recombinant Protein