TXN (Human) Recombinant Protein Ver mas grande

TXN (Human) Recombinant Protein

AB-P3454

Producto nuevo

TXN (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 100 ug
Gene Name TXN
Gene Alias DKFZp686B1993|MGC61975|TRX|TRX1
Gene Description thioredoxin
Storage Conditions Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In PBS, pH 7.4.
Gene ID 7295

Más información

Human TXN (NP_003320, 1 a.a. - 105 a.a.) full-length recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

TXN (Human) Recombinant Protein

TXN (Human) Recombinant Protein