Ver mas grande
IGF1 (Human) Recombinant Protein
AB-P3452
Producto nuevo
IGF1 (Human) Recombinant Protein
Comprando este producto generará 1 Biopunto. Su cesta contiene un total 1 Biopunto puede ser convertido en un Biobonos Descuento 4.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | IGF1 |
| Gene Alias | IGFI |
| Gene Description | insulin-like growth factor 1 (somatomedin C) |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In PBS, pH 7.4. |
| Gene ID | 3479 |
Más información
Human IGF1 (NP_000609, 49 a.a. - 118 a.a.) partial recombinant protein expressed in Escherichia coli.