CSF3 (Human) Recombinant Protein
  • CSF3 (Human) Recombinant Protein

CSF3 (Human) Recombinant Protein

Ref: AB-P3449
CSF3 (Human) Recombinant Protein

Información del producto

Human CSF3 (NP_757373, 31 a.a. - 204 a.a.) partial recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name CSF3
Gene Alias G-CSF|GCSF|MGC45931
Gene Description colony stimulating factor 3 (granulocyte)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.5 mg/mL
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In PBS, pH 7.4 (10% glycerol).
Gene ID 1440

Enviar un mensaje


CSF3 (Human) Recombinant Protein

CSF3 (Human) Recombinant Protein