PIN1 (Human) Recombinant Protein
  • PIN1 (Human) Recombinant Protein

PIN1 (Human) Recombinant Protein

Ref: AB-P3447
PIN1 (Human) Recombinant Protein

Información del producto

Human PIN1 (NP_006212, 1 a.a. - 163 a.a.) full-length recombinant protein expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name PIN1
Gene Alias DOD|UBL5
Gene Description peptidylprolyl cis/trans isomerase, NIMA-interacting 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 14% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 7.5 (5 mM DTT, 20% glycerol).
Gene ID 5300

Enviar un mensaje


PIN1 (Human) Recombinant Protein

PIN1 (Human) Recombinant Protein