PPM1A (Human) Recombinant Protein
  • PPM1A (Human) Recombinant Protein

PPM1A (Human) Recombinant Protein

Ref: AB-P3446
PPM1A (Human) Recombinant Protein

Información del producto

Human PPM1A (NP_066283, 1 a.a. - 382 a.a.) full-length recombinant protein expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name PPM1A
Gene Alias FLJ42306|MGC9201|PP2C-ALPHA|PP2CA
Gene Description protein phosphatase 1A (formerly 2C), magnesium-dependent, alpha isoform
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWILMGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKYCCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEP
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 10% SDS-PAGE
Storage Buffer In 10 mM Tris-HCl, 50 mM NaCl, 1 mM MnCl2, pH 7.5 (2 mM DTT, 20%glycerol).
Gene ID 5494

Enviar un mensaje


PPM1A (Human) Recombinant Protein

PPM1A (Human) Recombinant Protein