AB-P3421
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Size | 10 ug |
Gene Name | TFAM |
Gene Alias | MtTF1|TCF6|TCF6L1|TCF6L2|TCF6L3|mtTFA |
Gene Description | transcription factor A, mitochondrial |
Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Concentration | 0.25 mg/mL |
Application Key | SDS-PAGE |
Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC |
Form | Liquid |
Antigen species Target species | Human |
Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
Storage Buffer | In 20 mM Tris-HCl buffer, 0.2 M NaCl, pH 8.0 (20% glycerol, 5 mM DTT). |
Gene ID | 7019 |