Ver mas grande
TFAM (Human) Recombinant Protein
AB-P3421
Producto nuevo
TFAM (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | TFAM |
| Gene Alias | MtTF1|TCF6|TCF6L1|TCF6L2|TCF6L3|mtTFA |
| Gene Description | transcription factor A, mitochondrial |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 0.25 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In 20 mM Tris-HCl buffer, 0.2 M NaCl, pH 8.0 (20% glycerol, 5 mM DTT). |
| Gene ID | 7019 |
Más información
Human TFAM (NP_003192, 43 a.a. - 246 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.