GADD45B (Human) Recombinant Protein
  • GADD45B (Human) Recombinant Protein

GADD45B (Human) Recombinant Protein

Ref: AB-P3397
GADD45B (Human) Recombinant Protein

Información del producto

Human GADD45B (NP_056490, 1 a.a. - 160 a.a.) full-length recombinant protein expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name GADD45B
Gene Alias DKFZp566B133|GADD45BETA|MYD118
Gene Description growth arrest and DNA-damage-inducible, beta
Storage Conditions Store at 2C to 8C for 1 week. For long term storage store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER
Form Liquid
Antigen species Target species Human
Quality control testing 3 ug by 15% SDS-PAGE under reducing condition and visualized by Coomassie blue stain.
Storage Buffer In 20 mM Tris-HCl buffer, pH 7.5.
Gene ID 4616

Enviar un mensaje


GADD45B (Human) Recombinant Protein

GADD45B (Human) Recombinant Protein