Ver mas grande
GADD45B (Human) Recombinant Protein
AB-P3397
Producto nuevo
GADD45B (Human) Recombinant Protein
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | GADD45B |
| Gene Alias | DKFZp566B133|GADD45BETA|MYD118 |
| Gene Description | growth arrest and DNA-damage-inducible, beta |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MTLEELVACDNAAQKMQTVTAAVEELLVAAQRQDRLTVGVYESAKLMNVDPDSVVLCLLAIDEEEEDDIALQIHFTLIQSFCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAWKSHGLVEVASYCEESRGNNQWVPYISLQER |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | 3 ug by 15% SDS-PAGE under reducing condition and visualized by Coomassie blue stain. |
| Storage Buffer | In 20 mM Tris-HCl buffer, pH 7.5. |
| Gene ID | 4616 |
Más información
Human GADD45B (NP_056490, 1 a.a. - 160 a.a.) full-length recombinant protein expressed in Escherichia coli.