LILRA5 (Human) Recombinant Protein
  • LILRA5 (Human) Recombinant Protein

LILRA5 (Human) Recombinant Protein

Ref: AB-H00353514-G01
LILRA5 (Human) Recombinant Protein

Información del producto

Human LILRA5 full-length ORF (NP_067073.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 10 ug
Gene Name LILRA5
Gene Alias CD85|CD85F|ILT11|LILRB7|LIR9
Gene Description leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MAPWSHPSAQLQPVGGDAVSPALMVLLCLGLSLGPRTHVQAGNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTA
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 353514

Enviar un mensaje


LILRA5 (Human) Recombinant Protein

LILRA5 (Human) Recombinant Protein