TAS2R60 (Human) Recombinant Protein
  • TAS2R60 (Human) Recombinant Protein

TAS2R60 (Human) Recombinant Protein

Ref: AB-H00338398-G01
TAS2R60 (Human) Recombinant Protein

Información del producto

Human TAS2R60 full-length ORF (NP_803186.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size 2 ug
Gene Name TAS2R60
Gene Alias MGC119154|MGC119155|T2R56|T2R60
Gene Description taste receptor, type 2, member 60
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MNGDHMVLGSSVTDKKAIILVTILLLLRLVAIAGNGFITAALGVEWVLRRMLLPCDKLLVSLGASRFCLQSVVMGKTIYVFLHPMAFPYNPVLQFLAFQWDFLNAATLWSSTWLSVFYCVKIATFTHPVFFWLKHKLSGWLPWMLFSSVGLSSFTTILFFIGNHRMYQNYLRNHLQPWNVTGDSIRSYCEKFYLFPLKMITWTMPTAVFFICMILLITSLGRHRKKALLTTSGFREPSVQAHIKALLALLSFAML
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 338398

Enviar un mensaje


TAS2R60 (Human) Recombinant Protein

TAS2R60 (Human) Recombinant Protein