IQUB (Human) Recombinant Protein (P01)
  • IQUB (Human) Recombinant Protein (P01)

IQUB (Human) Recombinant Protein (P01)

Ref: AB-H00154865-P01
IQUB (Human) Recombinant Protein (P01)

Información del producto

Human IQUB full-length ORF ( AAH91520.1, 1 a.a. - 791 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name IQUB
Gene Alias FLJ35834|MGC149284|MGC149285
Gene Description IQ motif and ubiquitin domain containing
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq MSNQQEKYEAQNIVNSTEESDDAFDTVTIPVPSEEPQESDQTEEHESGIEQFSESHAIHVEEQSDQSFSSLEPDNEQLMEEVISPRQVSYTPQHHEKQYAMQRPNDDSLAFLDKIKSVKESLQESMEDSLATVKVVLIPVGQEIVIPFKVDTILKYLKDHFSHLLGIPHSVLQIRYSGKILKNNETLVQHGVKPQEIVQVEIFSTNPDLYPVRRIDGLTDVSQIITVTVQTGLDQYQQVPVEIVKSDFHKPFLGG
Antigen species Target species Human
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 154865

Enviar un mensaje


IQUB (Human) Recombinant Protein (P01)

IQUB (Human) Recombinant Protein (P01)