Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
OR6B3 (Human) Recombinant Protein
Abnova
OR6B3 (Human) Recombinant Protein
Ref: AB-H00150681-G01
OR6B3 (Human) Recombinant Protein
Contáctenos
Información del producto
Human OR6B3 full-length ORF (NP_775486.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).
Información adicional
Size
2 ug
Gene Name
OR6B3
Gene Alias
OR6B3P|OR6B3Q
Gene Description
olfactory receptor, family 6, subfamily B, member 3
Storage Conditions
Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key
AP
Immunogen Prot. Seq
MSGENVTRVGTFILVGFPTAPGLQYLLFLLFLLTYLFVLVENLAIILTVWSSTSLHRPMYYFLSSMSFLEIWYVSDITPKMLEGFLLQQKRISFVGCMTQLYFFSSLVCTECVLLASMAYDRYVAICHPLRYHVLVTPGLCLQLVGFSFVSGFTISMIKVCFISSVTFCGSNVLNHFFCDISPILKLACTDFSTAELVDFILAFIILVFPLLATMLSYAHITLAVLRIPSATGCWRAFFTCASHLTVVTVFYTAL
Form
Liquid
Recomended Dilution
Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species
Human
Storage Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID
150681
Enviar un mensaje
OR6B3 (Human) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*