AB-H00124599-G01
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.
Size | 10 ug |
Gene Name | CD300LB |
Gene Alias | CD300b|CLM7|IREM3|TREM5 |
Gene Description | CD300 molecule-like family member b |
Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
Application Key | AP |
Immunogen Prot. Seq | MCRRCKPELGQNFQSASGICICHWLQIRRTRSREGRAMWLPPALLLLSLSGCFSIQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHYMLLVFVKVPILLILVTAILWLKGSQRVPEEPGEQPIYMNFSEPLTKDMAT |
Form | Liquid |
Recomended Dilution | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
Antigen species Target species | Human |
Storage Buffer | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene ID | 124599 |