OR5P2 (Human) Recombinant Protein Ver mas grande

OR5P2 (Human) Recombinant Protein

AB-H00120065-G01

Producto nuevo

OR5P2 (Human) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.


Hoja técnica

Size 2 ug
Gene Name OR5P2
Gene Alias JCG3|JCG4|MGC126759|MGC142117
Gene Description olfactory receptor, family 5, subfamily P, member 2
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key AP
Immunogen Prot. Seq MNSLKDGNHTALTGFILLGLTDDPILRVILFMIILSGNLSIIILIRISSQLHHPMYFFLSHLAFADMAYSSSVTPNMLVNFLVERNTVSYLGCAIQLGSAAFFATVECVLLAAMAYDRFVAICSPLLYSTKMSTQVSVQLLLVVYIAGFLIAVSYTTSFYFLLFCGPNQVNHFFCDFAPLLELSCSDISVSTVVLSFSSGSIIVVTVCVIAVCYIYILITILKMRSTEGHHKAFSTCTSHLTVVTLFYGTITFIY
Form Liquid
Recomended Dilution Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Antigen species Target species Human
Storage Buffer 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene ID 120065

Más información

Human OR5P2 full-length ORF (NP_703145.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).

Consulta sobre un producto

OR5P2 (Human) Recombinant Protein

OR5P2 (Human) Recombinant Protein